PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00018.1.g01050.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 894aa    MW: 95638.7 Da    PI: 8.9486
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00018.1.g01050.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40216292278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v+gC+adls+++eyhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Zjn_sc00018.1.g01050.1.am.mk 216 CAVDGCDADLSKCREYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHSLVEFDEAKRSCRKRLDGHNRRRRKPQP 292
                                   **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-34208277IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129213290IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37214295IPR004333Transcription factor, SBP-box
PfamPF031101.1E-30216289IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 894 aa     Download sequence    Send to blast
MWPGAMLWCL FSEHKGSMPL LKGEHGPGAP LGPSPLESLQ PSTSRKLCIC CASSISLASS  60
LSLRALARGH GHGHEQKASS LALQRPRNTS VAWWCLMDWD LKMPVSWDLA ELEHDTVPAI  120
SAPTAPVAAA ASGIATAAAA ARGTPTRAEC SVDLKLGGLG DFGAAEVTKE PKPPAKGPAV  180
TVSSPPAASA VVPSASPLKR PRTGPGGANG PQCPSCAVDG CDADLSKCRE YHRRHKVCEA  240
HSKTPVVVVA GREMRFCQQC SRFHSLVEFD EAKRSCRKRL DGHNRRRRKP QPDDMNARSF  300
MTSQQGPRSS SFVTPRPEPS WSGILKSEDS SYYAHQVLCN RPHFAGSTST YSKEGRRFPF  360
LQDGDQLSFG TGGAASLEAA TACQSLLKTV AAPESSSSSK IFSPDGLTPV LDSDCALSLL  420
SSPANSSSVD VSRMVQPTEH IPMAQPLVPS MQQFGSSPSW FSQAASSGVV VSTAGFTCPS  480
MDSEQLNPVL VPSSDGHEMN YHGIFHVGGE GSDDGTSSSL PFSSTTSVEV HTKPDAAVSN  540
LEQMIQFRPE AAVKHGTIPL CSPDAALLSS LLDPQRVCLC SLATHGRQGL GRWLVPPQCT  600
AVGTRQGRLA RKPLRPDCIP RAAGGRQGTK FCLARPGAGR GRADKASEHG KMSVLGVQAS  660
KVEWHVTSRG AEQPPRATGR PPDLGIVDRH VVKLMMGSCR VRAPYDVAPH PAIPPPTARV  720
RARYPAYWTA CVMLDKICFP VRPCQPDAAG GPSNRWFRTA DDGVRVHNLG LAPLAEGWRE  780
VSVLYSLVPL VTTEKPSRLT LTGELRPVCS NCGNQSLASS RAEPERQPRR PVAGLEEAGN  840
DAAHGKRKGG VAQKYDSTRF HPEKYTLYAL FFISLPRPVE SSLVRRRDLQ TLVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-27204289184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1272289KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0538759e-86BT053875.1 Zea mays full-length cDNA clone ZM_BFb0379K14 mRNA, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-43SBP family protein